PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DS_69FBC78BC.2
Common NameNFYA-B4, NFYA-D4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 298aa    MW: 32520.5 Da    PI: 10.025
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DS_69FBC78BC.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.44.3e-32148204158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  Traes_2DS_69FBC78BC.2 148 EEPMFVNAKQYHAILRRRQIRAKLEAQNKL-VKARKPYLHESRHRHAMKRARGTGGRF 204
                            69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-37146207IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.001147207IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.4E-27149204IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-24150172IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860152172IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.5E-24181204IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEDHPGHPIS NYDFLSGNGC HTKKLVHKNY DQDSSSAKSG RSQQEASATS DSNLNEQHTS  60
RPPSQSDNDN DHGKPDQHMI KPLLSLGNPE TVAPPPMIDC SQSFAYVPYA ADAYAGIFPG  120
YASHAIVHPQ LNAATNSRVP LPIEPAAEEP MFVNAKQYHA ILRRRQIRAK LEAQNKLVKA  180
RKPYLHESRH RHAMKRARGT GGRFLNTKQL EEQKQVSGGA SCTKVHGKNT LLQGSPAFAP  240
SASAPSNMSS FSTTGMLANQ ERTCFPLVGF RPTVSFSALN GNGKLAPNGM HQRASMMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-23148209263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188197RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787530.0KM078753.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-B4) mRNA, complete cds.
GenBankKM0787540.0KM078754.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-D4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235752.11e-142PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLW5C5Q00.0W5C5Q0_WHEAT; CCAAT-binding transcription factor B
TrEMBLM8CJ460.0M8CJ46_AEGTA; Nuclear transcription factor Y subunit A-5
STRINGMLOC_67781.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.19e-40nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]
  2. Qu B, et al.
    A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input.
    Plant Physiol., 2015. 167(2): p. 411-23
    [PMID:25489021]